DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and LOC560023

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:234 Identity:83/234 - (35%)
Similarity:116/234 - (49%) Gaps:27/234 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQ---------IRA 85
            ||:||......|..:|:|||....|.|||::.....::|||||.:  .|||:|         :..
Zfish    43 RIIGGQEVVPYSIKYQVSLQVDRKHFCGGTLIQPQWVLTAAHCWR--PASVIQVVLSEHNLAVEE 105

  Fly    86 GSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNP---ANGAA 147
            |.....:....||      |..||..|..|||.|||:......::.::...|.:::.   |.|::
Zfish   106 GFEQVCTVAKVFS------HVAYNPKTFNNDIMIIKLTAPAQINAYVQPALLPTADTPELAGGSS 164

  Fly   148 ASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAA--SGKDACQGDS 210
            .:|||||.....:..:...|:.|:|.|.|..|..     |..::...||||.:  .|||:|||||
Zfish   165 CTVSGWGVTRLYNFYLSPILRAVDVEIFSSCQLY-----YYYRVNDNMICAGSRFGGKDSCQGDS 224

  Fly   211 GGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||||:..|.|.|:||||.|||...|||||..|.....|:
Zfish   225 GGPLICDGYLEGIVSWGIGCALPYYPGVYTKVRNYNRWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 82/232 (35%)
Tryp_SPc 31..252 CDD:238113 82/233 (35%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 82/232 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.