DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and Prss53

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:303 Identity:72/303 - (23%)
Similarity:125/303 - (41%) Gaps:87/303 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSV 76
            ||...|..|..  || :|..:.|      .:|||.|::|.|.|.|.||:.:...::|||||.:.:
  Rat    27 ACGQRGPGPPE--PQ-EGNTLPG------EWPWQASVRRQGVHICSGSLVADTWVLTAAHCFEKM 82

  Fly    77 SASVLQIRAGSSYW------------SSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFS 129
            :.:.|      |.|            |.|.....|::.:..:.||..:..:|:|::::...:..:
  Rat    83 ATAEL------SSWSVVLGSLKQEGLSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHPIVHT 141

  Fly   130 STIKAIGLASSNPAN----GAAASVSGW--------------------GTL-------SYGSSSI 163
            :      |....|.:    ||:...:||                    |::       |:..|.:
  Rat   142 T------LCLPQPTHHFPFGASCWATGWDQNTSDGKYCPRHKSRESQTGSVLTVLALCSHCVSEL 200

  Fly   164 PS---------QLQYVNVNIVSQSQCASSTYG------YGSQIRSTMICAAASG--KDACQGDSG 211
            .|         .|:.:.:.::|:..| :..|.      ..:..||.|:|..|..  :..||||||
  Rat   201 DSTLSPLPVSRTLRNLRLRLISRPTC-NCLYNRLHQRLLANPARSGMLCGGAQPGVQGPCQGDSG 264

  Fly   212 GPLV-----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||::     ...|.||::|:...||..:.|.:..|:||..||:
  Rat   265 GPVMCREPDGHWVQVGIISFTSNCAQEDTPVLLTDMAAHSSWL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 64/283 (23%)
Tryp_SPc 31..252 CDD:238113 65/284 (23%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 65/282 (23%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343317
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.