DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and LOC496633

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001011204.1 Gene:LOC496633 / 496633 -ID:- Length:249 Species:Xenopus tropicalis


Alignment Length:250 Identity:89/250 - (35%)
Similarity:121/250 - (48%) Gaps:16/250 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVT 68
            :::|..|||.|         .|..|.:||||...|..|.|||:...:.....||||:.:...|::
 Frog     5 WILLFLAVAAA---------APLDDDKIVGGYECTPHSQPWQVYFTQENQVFCGGSLVTPRWIIS 60

  Fly    69 AAHCLQSVSASVLQIRAGSSYWSSGGVT-FSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTI 132
            ||||.::....|..:.........|... ..|.:...|..|..|.:.:||.::|:.....::..:
 Frog    61 AAHCYRTPKTLVAHLGDHDLTKEEGTEQHIQVENIYKHFSYKDNDVDHDIMLVKLAKPAQYNQYV 125

  Fly   133 KAIGLASSNPANGAAASVSGWGTL-SYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMI 196
            :.|.:|.|.|..|....|||:|.: |......|.:||.|:|.::|.|.|.:|   |.......|.
 Frog   126 QPIPVARSCPREGTECLVSGYGNMRSDNIGEFPDRLQCVDVPVLSDSSCKAS---YRGLFTENMF 187

  Fly   197 CAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||.  ..|||:||.|||||||..|.|.||||||.|||..|.|||||.|.....||
 Frog   188 CAGFLEGGKDSCQVDSGGPLVCNGELYGVVSWGQGCAERNAPGVYAKVCNYLGWV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 80/222 (36%)
Tryp_SPc 31..252 CDD:238113 81/222 (36%)
LOC496633NP_001011204.1 Tryp_SPc 23..245 CDD:238113 81/222 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.