DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and ctrl

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001004582.1 Gene:ctrl / 447843 ZFINID:ZDB-GENE-040912-147 Length:261 Species:Danio rerio


Alignment Length:261 Identity:100/261 - (38%)
Similarity:135/261 - (51%) Gaps:19/261 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDG--RIVGGSATTISSFPWQISLQRS-GSHSCGGSIYS 62
            ||..:...:.||..||..|| .:.|.:.|  |||.|......|:|||:|||:| |.|.||||:.:
Zfish     1 MLWIISCFALVASTLGCGVP-AIKPVISGYNRIVNGENAVSGSWPWQVSLQQSNGFHFCGGSLIN 64

  Fly    63 SNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFK---NHEGYNANTMVNDIAIIKING 124
            ...:||||||  .|.|....:..|.....|...:..|.|..   .|..||:....|||.::|::.
Zfish    65 QYWVVTAAHC--RVQAGYHYVILGEHDRGSSAESVQVKSIAKAITHPYYNSQNFNNDITLLKLSS 127

  Fly   125 ALTFSSTIKAIGLASSNPA--NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGY 187
            ....:|.|..:.||:|:.:  :|.....:|||  ..||:|.|..||...:.::|.:||  ..|..
Zfish   128 PAQLTSRISPVCLAASSTSIPSGTRCVTTGWG--KTGSTSSPRILQQTALPLLSPAQC--KQYWG 188

  Fly   188 GSQIRSTMICAAASGKDACQGDSGGPLV--SGGV--LVGVVSWGYGCAYSNYPGVYADVAALRSW 248
            .::|...||||.|||..:||||||||||  |.|.  .||:||||........|.|||.|:.||.|
Zfish   189 QNRITDAMICAGASGVSSCQGDSGGPLVCESSGAWYQVGIVSWGTSDCNVRTPAVYARVSYLRQW 253

  Fly   249 V 249
            :
Zfish   254 I 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 89/228 (39%)
Tryp_SPc 31..252 CDD:238113 89/229 (39%)
ctrlNP_001004582.1 Tryp_SPc 31..254 CDD:214473 89/228 (39%)
Tryp_SPc 32..257 CDD:238113 89/229 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.