DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and Jon99Ciii

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001287598.1 Gene:Jon99Ciii / 43543 FlyBaseID:FBgn0003357 Length:265 Species:Drosophila melanogaster


Alignment Length:276 Identity:97/276 - (35%)
Similarity:129/276 - (46%) Gaps:40/276 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVP-EGLLP----QLDGRIVGGSATTISSFPWQISLQRSGSHS--CGG 58
            |..||.|..|||.|.....| :.|.|    .:.|||..|........|:.:.|..||:.:  |||
  Fly     1 MKLFVFLALAVAAATAVPAPAQKLTPTPIKDIQGRITNGYPAYEGKVPYIVGLLFSGNGNWWCGG 65

  Fly    59 SIYSSNVIVTAAHCLQSVSASVLQIRAGSS--------YWSSGGVTFSVSSFKNHEGYNANTMVN 115
            ||..:..::|||||..  .||.:.|..|:|        :|...|      ....|..||:..:.|
  Fly    66 SIIGNTWVLTAAHCTN--GASGVTINYGASIRTQPQYTHWVGSG------DIIQHHHYNSGNLHN 122

  Fly   116 DIAIIKINGALTFSSTIKAIGLASSNPA----NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVS 176
            ||::|: ...:.|.|.:..:.|.|.|..    .|..|..||||. :|..|.:|..||.|:|.|:|
  Fly   123 DISLIR-TPHVDFWSLVNKVELPSYNDRYQDYAGWWAVASGWGG-TYDGSPLPDWLQSVDVQIIS 185

  Fly   177 QSQCASSTYGYGSQIRSTMICA-AASGKDACQGDSGGPLVS--GGVLVGVVSWG--YGCAYSNYP 236
            ||.| |.|:    .:...|||. ...||..|.||||||||:  |..||||.|:|  .|| .|..|
  Fly   186 QSDC-SRTW----SLHDNMICINTDGGKSTCGGDSGGPLVTHDGNRLVGVTSFGSAAGC-QSGAP 244

  Fly   237 GVYADVAALRSWVINN 252
            .|::.|.....|:.:|
  Fly   245 AVFSRVTGYLDWIRDN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 83/237 (35%)
Tryp_SPc 31..252 CDD:238113 83/239 (35%)
Jon99CiiiNP_001287598.1 Tryp_SPc 36..260 CDD:238113 83/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.