DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and CG31265

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650599.1 Gene:CG31265 / 42068 FlyBaseID:FBgn0051265 Length:266 Species:Drosophila melanogaster


Alignment Length:241 Identity:85/241 - (35%)
Similarity:126/241 - (52%) Gaps:21/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GTVPEGLLPQLDGRIVGGSATTISSFPWQISLQR-SGSHSCGGSIYSSNVIVTAAHCLQSVSASV 80
            |..|.|    ..|||.||....|...|:|:|||. .|||:|||:|.:.|.|:||.||:::...::
  Fly    27 GPFPAG----QSGRIKGGEEAEIGFAPYQVSLQPIVGSHNCGGAILNENWIITAGHCVENFIPAL 87

  Fly    81 LQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANG 145
            :.:..|::.|:..|..:..:....|..|:...|.||||::|:...:||:...:.|.|.:.....|
  Fly    88 VNVITGTNKWAEPGAIYYTAEIHKHCMYDQPYMHNDIALVKLTENITFNELTQPIALPTRPVQLG 152

  Fly   146 AAASVSGWGT-LSYGSSSIPSQLQYVNVNIVSQSQC-----ASSTYGYGSQIRSTMICA-AASGK 203
            ....::|||: ::||||.  ..|..:.|.:|...:|     .:|:.|.|.      ||. :..|:
  Fly   153 EEIVLTGWGSDVAYGSSM--EDLHKLTVGLVPLDECYETFNRTSSMGVGH------ICTFSREGE 209

  Fly   204 DACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            .||.|||||||||.|.|||||:||..|.. ..|.|.|:|.....|:
  Fly   210 GACHGDSGGPLVSNGQLVGVVNWGRPCGV-GLPDVQANVYYYLDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 80/226 (35%)
Tryp_SPc 31..252 CDD:238113 80/227 (35%)
CG31265NP_650599.1 Tryp_SPc 36..254 CDD:214473 80/226 (35%)
Tryp_SPc 39..257 CDD:238113 79/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443304
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.950

Return to query results.
Submit another query.