DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and CG17477

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_650598.1 Gene:CG17477 / 42067 FlyBaseID:FBgn0038479 Length:267 Species:Drosophila melanogaster


Alignment Length:252 Identity:82/252 - (32%)
Similarity:131/252 - (51%) Gaps:15/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQR-SGSHSCGGSIYSSNV 65
            |.::::.|::.|.         |..|:..||||........|:|:|||. .|||.|||:|.|...
  Fly     7 LFYILVFSSLYCD---------LLALEHFIVGGQNAAEGDAPYQVSLQTLLGSHLCGGAIISDRW 62

  Fly    66 IVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSS 130
            |:||.||::....|.||:..|:..::..|..:...:...|..|::....|||.::.:|.::||::
  Fly    63 IITAGHCVKGYPTSRLQVATGTIRYAEPGAVYYPDAIYLHCNYDSPKYQNDIGLLHLNESITFNA 127

  Fly   131 TIKAIGLASSNPANGAAASV-SGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGS-QIRS 193
            ..:|:.|.:|....||:..| :|||:.| .:.|:|||||.|....::...|.|....|.. ::..
  Fly   128 LTQAVELPTSPFPRGASELVFTGWGSQS-AAGSLPSQLQRVQQQHLNSPACESMMSAYEDLELGP 191

  Fly   194 TMICAAASGK-DACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ..|||..... .||.||||||||..|.|||::::...|| ...|.::.::...|.|:
  Fly   192 CHICAYRQANIGACHGDSGGPLVHQGTLVGILNFFVPCA-QGVPDIFMNIMYYRDWM 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 76/222 (34%)
Tryp_SPc 31..252 CDD:238113 77/223 (35%)
CG17477NP_650598.1 Tryp_SPc 27..250 CDD:238113 77/223 (35%)
Tryp_SPc 27..246 CDD:214473 76/220 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.