DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:242 Identity:86/242 - (35%)
Similarity:120/242 - (49%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIR-AGSSYWSSG 93
            ::.||.......:|||.|||::..|.||.::.|::.::|||||.         :| |....|.  
  Rat   186 KVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCF---------VRSANPKDWK-- 239

  Fly    94 GVTF-----------SVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSN---PAN 144
             |:|           :|.|...||.|:.....||||:::::..:.:.:.|:...|..:.   |.|
  Rat   240 -VSFGFLLSKPQAQRAVKSIVIHENYSYPAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPN 303

  Fly   145 GAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA-ASGK-DACQ 207
            .... |:|||||.....| |:.||...|.|:....| :|...||..|...|:||. ..|: ||||
  Rat   304 SDVV-VTGWGTLKSDGDS-PNILQKGRVKIIDNKTC-NSGKAYGGVITPGMLCAGFLEGRVDACQ 365

  Fly   208 GDSGGPLV---SGGV--LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||||||||   |.|:  |.|:||||..||..|.||||..|...|.|:
  Rat   366 GDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 85/240 (35%)
Tryp_SPc 31..252 CDD:238113 86/241 (36%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 85/240 (35%)
Tryp_SPc 187..415 CDD:238113 86/241 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.