DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and Klk4

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001004101.1 Gene:Klk4 / 408210 RGDID:1303228 Length:256 Species:Rattus norvegicus


Alignment Length:235 Identity:75/235 - (31%)
Similarity:107/235 - (45%) Gaps:21/235 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGSATTIS------------SFPWQISL-QRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQ 82
            :.|.||::||            |.|||.:| ....:..|.|.:.....:::||||:|......|.
  Rat    20 VTGSSASSISSRIIQGQDCLPHSQPWQAALFSEDNAFFCSGVLVHPQWVLSAAHCIQDSYTVGLG 84

  Fly    83 IRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAA 147
            :.........|...........|..||..:..||:.:||:|.::..|:||:.|.:||..|..|..
  Rat    85 LHNLEGSQEPGSRMLEAHLSIQHPNYNDPSFANDLMLIKLNESVMESNTIRRIPVASQCPTPGDT 149

  Fly   148 ASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAA--SGKDACQGDS 210
            ..|||||.|..|  .:||.||.||:::.|:..|...   |......:|.||..  ..||.|.|||
  Rat   150 CLVSGWGRLKNG--KLPSLLQCVNLSVASEETCRLL---YDPVYHLSMFCAGGGPDRKDTCNGDS 209

  Fly   211 GGPLVSGGVLVGVVSWGYG-CAYSNYPGVYADVAALRSWV 249
            |||:|....|.|:||.|.| |.....|.||.::....:|:
  Rat   210 GGPIVCNRSLQGLVSMGQGECGQPGIPSVYTNLCKFTNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 74/233 (32%)
Tryp_SPc 31..252 CDD:238113 75/235 (32%)
Klk4NP_001004101.1 Tryp_SPc 35..249 CDD:238113 69/218 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.