DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and CG3650

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:255 Identity:95/255 - (37%)
Similarity:146/255 - (57%) Gaps:12/255 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSF-PWQISLQRSGSHSCGGSIYSSN 64
            |.:.:.||......||  :..|   |:..|||||:.||:|:. .:.::|:..|:..||||:.:|:
  Fly     1 MWRPLFLLQLTQLLLG--LASG---QIQPRIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSS 60

  Fly    65 VIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFS 129
            .:|||||||:...||.:.::.|.|..|..||...|:.:....|::::::..|:.:|::..||| .
  Fly    61 HVVTAAHCLKGYQASRITVQGGVSKLSQSGVVRRVARYFIPNGFSSSSLNWDVGVIRLQSALT-G 124

  Fly   130 STIKAIGLASS--NPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192
            |.|..|.|...  ||.|  ...||||||..||:||..:||:.|.:.::.:..|..:..|..:...
  Fly   125 SGITTIPLCQVQWNPGN--YMRVSGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLTA 187

  Fly   193 STMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVINN 252
            || .||...|||:|.|||||.::....|.|:||||.|||.:.|||||..|..:||:::.:
  Fly   188 ST-FCARTGGKDSCSGDSGGGVIFKNQLCGIVSWGLGCANAQYPGVYTSVHRVRSFILRS 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 88/221 (40%)
Tryp_SPc 31..252 CDD:238113 87/223 (39%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 88/221 (40%)
Tryp_SPc 26..243 CDD:238113 87/220 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.