DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and CG9897

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:276 Identity:88/276 - (31%)
Similarity:126/276 - (45%) Gaps:38/276 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQL---DGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYS 62
            ||..:|||..||           ||.|   |.||:.|:...|...||..|:..:....|||:|.|
  Fly     1 MLAPLILLQIVA-----------LPWLALGDQRIINGNTVNIKDAPWYASIIVNSKLKCGGAIIS 54

  Fly    63 SNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALT 127
            .|.|:|||.|:...||..:|:|.|:|...:.|....:...|.|..|::....|::|::|....|.
  Fly    55 KNYILTAAKCVDGYSARSIQVRLGTSSCGTSGSIAGICKVKVHSQYSSWRFDNNLALLKTCELLN 119

  Fly   128 FSSTIKAIGLASSNPANGAAASVSGWG-------------TLSYGSS----SIPSQLQYVNVNIV 175
            .:..||.|..|...|.:.:.|:|:|.|             .:|.|..    .:|.||....|.|:
  Fly   120 TTDEIKPIERADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVRIL 184

  Fly   176 SQSQCASS----TYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYP 236
            ||.|||:.    .:.....|....||..:.||.||..|.|.|||....|||::|.. ||:..  |
  Fly   185 SQKQCAADWKVIPFYLLKGISDLTICTKSPGKGACSTDRGSPLVIDNKLVGILSRA-GCSIK--P 246

  Fly   237 GVYADVAALRSWVINN 252
            .|||::....:|:.:|
  Fly   247 DVYANILGHTNWLDSN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 75/239 (31%)
Tryp_SPc 31..252 CDD:238113 75/241 (31%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.