DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and tpr

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:253 Identity:87/253 - (34%)
Similarity:126/253 - (49%) Gaps:26/253 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 CALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCL---- 73
            |..|       :..:..|||||..|.:..:||...|...|...|..|:.:...::||:||:    
  Fly   116 CVCG-------IANIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYGFR 173

  Fly    74 -QSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGL 137
             :.:|..:|:.....|:...  :...|:....|..|||....|||||||::..:.|:..:..:.:
  Fly   174 KERISVRLLEHDRKMSHMQK--IDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCM 236

  Fly   138 ASSNPA-NGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAA-- 199
            .:...: .|....|:|||.|..|..: ...||.|.|.|:||.:|..|.  ||::|...|:|..  
  Fly   237 PTPGRSFKGENGIVTGWGALKVGGPT-SDTLQEVQVPILSQDECRKSR--YGNKITDNMLCGGYD 298

  Fly   200 ASGKDACQGDSGGPL--VSGGV----LVGVVSWGYGCAYSNYPGVYADVAALRSWVIN 251
            ..|||:|||||||||  |:.|.    :.||||||.|||.:.||||||.|....:|:.|
  Fly   299 EGGKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKN 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 83/232 (36%)
Tryp_SPc 31..252 CDD:238113 84/235 (36%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 83/232 (36%)
Tryp_SPc 127..356 CDD:238113 83/233 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.