DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and CG17571

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001286096.1 Gene:CG17571 / 35409 FlyBaseID:FBgn0259998 Length:258 Species:Drosophila melanogaster


Alignment Length:256 Identity:130/256 - (50%)
Similarity:171/256 - (66%) Gaps:11/256 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLD---GRIVGGSATTISSFPWQISLQRS-GSHSCGGSIY 61
            :|..|:.|.|:|.:..|.      |.||   ||||.|....|.::|:|:|:|.: |||.||||:.
  Fly     4 LLLSVVALVALAASCHGN------PGLDFPFGRIVNGEDVDIENYPYQVSVQTTKGSHFCGGSLI 62

  Fly    62 SSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGAL 126
            .|..::|||||:||.:||.||:|.||:..||||...:|.:||.|||||:..|:||:||||::..:
  Fly    63 DSETVLTAAHCMQSYAASELQVRVGSTSRSSGGEVVTVRAFKYHEGYNSKLMINDVAIIKLSSPV 127

  Fly   127 TFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGS-Q 190
            ..:|.|:||.||.|...:|..|.||||||..:...|.|..||.|.|:::....||:.||.||| .
  Fly   128 RQTSKIRAIELADSEAVSGTNAVVSGWGTTCFLFCSSPDTLQKVEVDLLHYKDCAADTYNYGSDS 192

  Fly   191 IRSTMICAAASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWVIN 251
            |..||:||....|||||||||||||:...||||||||.|||::.|||||||||:||||:::
  Fly   193 ILETMVCATGEKKDACQGDSGGPLVADNKLVGVVSWGSGCAWTGYPGVYADVASLRSWIVD 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 119/220 (54%)
Tryp_SPc 31..252 CDD:238113 119/223 (53%)
CG17571NP_001286096.1 Tryp_SPc 30..251 CDD:214473 119/220 (54%)
Tryp_SPc 31..254 CDD:238113 119/223 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45443161
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
98.850

Return to query results.
Submit another query.