DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and Prss53

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:267 Identity:70/267 - (26%)
Similarity:118/267 - (44%) Gaps:54/267 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 ACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSV 76
            ||...|..|..  || :|..:.|      .:|||.|::|.|.|.|.||:.:...::|||||.:.:
Mouse    27 ACGQRGPGPPE--PQ-EGNTLPG------EWPWQASVRRQGVHICSGSLVADTWVLTAAHCFEKM 82

  Fly    77 SASVLQIRAGSSYW------------SSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFS 129
            :.:.|      |.|            |.|.....|::.:..:.||..:..:|:|::::... |..
Mouse    83 ATAEL------SSWSVVLGSLKQEGQSPGAEEVGVAALQLPKAYNHYSQGSDLALLQLTHP-TVQ 140

  Fly   130 STIKAIGLASSNPAN----GAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYG---- 186
            :|     |....|..    ||:...:||   ...:|.:...|:.:.:.::|:..| :..|.    
Mouse   141 TT-----LCLPQPTYHFPFGASCWATGW---DQNTSDVSRTLRNLRLRLISRPTC-NCLYNRLHQ 196

  Fly   187 --YGSQIRSTMICAAAS-GKDA-CQGDSGGPLV-----SGGVLVGVVSWGYGCAYSNYPGVYADV 242
              ..:..|..|:|..|. |:.. ||||||||::     ...|.||::|:...||..:.|.:..|:
Mouse   197 RLLSNPARPGMLCGGAQPGEQGPCQGDSGGPVMCREPDGHWVQVGIISFTSKCAQEDTPVLLTDM 261

  Fly   243 AALRSWV 249
            |...||:
Mouse   262 AVHSSWL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 62/247 (25%)
Tryp_SPc 31..252 CDD:238113 63/248 (25%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 7/21 (33%)
Tryp_SPc 45..271 CDD:238113 63/246 (26%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.