DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and CG9672

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:260 Identity:65/260 - (25%)
Similarity:107/260 - (41%) Gaps:25/260 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVI 66
            :|..:.:..:..|.|     .|..|..|||.||....:...|:|.:|...||::||..|......
  Fly     1 MKLTLTIGLILVAAG-----VLEAQPQGRIAGGEDAVLGQLPYQAALSIGGSYNCGAVIIGQRYA 60

  Fly    67 VTAAHCLQSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGY-----------NANTMVNDIAII 120
            :||..|:.|        ....:.|::.....:|.|...:.|.           |.:|:...||::
  Fly    61 LTALSCVCS--------DGKDTPWAAVLFAVTVGSVDLYNGKQIRVEEITINPNYSTLKTGIALL 117

  Fly   121 KINGALTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTY 185
            ::...:|||.|:.||.|:...|..|:...|||||..:....::...||.....:::..:||.:..
  Fly   118 RLQEEITFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALANR 182

  Fly   186 GYGSQIRSTMICAAASGKDA-CQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            .........::|.....:.. |.||.|||.|..|.|||:.:...|......|..:..:||...|:
  Fly   183 DELLVADDQVLCLGHGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAANYDWI 247

  Fly   250  249
              Fly   248  247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 58/230 (25%)
Tryp_SPc 31..252 CDD:238113 58/231 (25%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 58/230 (25%)
Tryp_SPc 25..250 CDD:238113 58/231 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.