DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and CG32376

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster


Alignment Length:221 Identity:78/221 - (35%)
Similarity:109/221 - (49%) Gaps:2/221 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGG 94
            |||.|.....:..|:|.||...|...||..|.:...|:||.||... ......:|.||.....||
  Fly    65 RIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFG-PPEKYTVRVGSDQQRRGG 128

  Fly    95 VTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPAN-GAAASVSGWGTLSY 158
            ....|........||..||.:|:|::|:...:.|...::.:.|.|:.... .....|||||..|.
  Fly   129 QLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFVVSGWGITSA 193

  Fly   159 GSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASGKDACQGDSGGPLVSGGVLVGV 223
            .:.::...|:.|.::.:.:|:|.......|.:|...||||:.:.||:|.|||||||.|.|||.|:
  Fly   194 NAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASRTNKDSCSGDSGGPLTSRGVLYGI 258

  Fly   224 VSWGYGCAYSNYPGVYADVAALRSWV 249
            ||||.|||..||||||.:......|:
  Fly   259 VSWGIGCANKNYPGVYVNCKRYVPWI 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 77/219 (35%)
Tryp_SPc 31..252 CDD:238113 77/220 (35%)
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 77/219 (35%)
Tryp_SPc 66..287 CDD:238113 77/220 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
43.910

Return to query results.
Submit another query.