DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and Klk14

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_777355.1 Gene:Klk14 / 317653 MGIID:2447564 Length:250 Species:Mus musculus


Alignment Length:257 Identity:95/257 - (36%)
Similarity:134/257 - (52%) Gaps:22/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHS--CGGSIYSS 63
            |...:|:|.|:|.|:..:       |.|.:|:||.....:|.|||::||....|.  |||.:.|.
Mouse     1 MFLLLIILQALAVAIAQS-------QGDHKIIGGYRCVRNSQPWQVALQAGPGHRFLCGGVLLSD 58

  Fly    64 NVIVTAAHCLQSVSASVLQIRAGS---SYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGA 125
            ..::|||||    :..:|.:..|.   ..|.:......|:....|..|......||:.::|:...
Mouse    59 QWVITAAHC----ARPILHVALGKHNIRRWEATQQVVRVARQVPHPQYQPQAHDNDLMLLKLQKK 119

  Fly   126 LTFSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQ 190
            :.....:|.|.:|||..:.|....||||||::...:..|:.||.|||||:|:..|..:   |...
Mouse   120 VRLGRAVKTISVASSCASPGTPCRVSGWGTIASPIARYPTALQCVNVNIMSEQACHRA---YPGI 181

  Fly   191 IRSTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWGY-GCAYSNYPGVYADVAALRSWV 249
            |.|.|:||..  .|||:||||||||||.||.|.|:||||. .||...||||||::....||:
Mouse   182 ITSGMVCAGVPEGGKDSCQGDSGGPLVCGGQLQGLVSWGMERCAMPGYPGVYANLCNYHSWI 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 86/226 (38%)
Tryp_SPc 31..252 CDD:238113 87/227 (38%)
Klk14NP_777355.1 Tryp_SPc 24..246 CDD:238113 87/227 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 156 1.000 Domainoid score I4174
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm43743
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.