DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and CG6041

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:270 Identity:88/270 - (32%)
Similarity:138/270 - (51%) Gaps:26/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGS--------HSCG 57
            :|...:.|.|:|.  |.::......:::.:||||...:|....:|:|::.:.:        |.||
  Fly     7 ILAIALFLGALAS--GESLSSETAGKIEPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGHLCG 69

  Fly    58 GSIYSSNVIVTAAHCLQSV------SASVLQIRAGSSYWSSG---GVTFSVSSFKNHEGYNANTM 113
            |.:.|..::.|||||....      :|....:..||:|.:|.   .:.:.:.....||.||.:.:
  Fly    70 GVVISQRLVATAAHCCYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQLITHENYNPDAL 134

  Fly   114 VNDIAIIKINGALTFS-STIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQ 177
            .||||::.|||.:.:: .|:.|:.|.|...|......:||||.|....:...:.||...|.|||.
  Fly   135 TNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSNTLQAATVPIVSY 199

  Fly   178 SQCASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYA 240
            :.|..|   |.| |..:.:||.  :.|.||||||||||:...|:|.|:||:|.|||...|||||.
  Fly   200 TTCRIS---YNS-IPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAGCAAPGYPGVYT 260

  Fly   241 DVAALRSWVI 250
            :|:....|::
  Fly   261 NVSYYYDWIV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 82/238 (34%)
Tryp_SPc 31..252 CDD:238113 83/240 (35%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 82/238 (34%)
Tryp_SPc 35..272 CDD:238113 83/240 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.