DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and CG14780

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:272 Identity:85/272 - (31%)
Similarity:121/272 - (44%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQ------RSGS-HSCGGSIY 61
            :::....:|||..     .|......||:.||..........:|::      ..|| |.|||::.
  Fly    11 YILFWFLLACAAA-----DLQENQQSRIINGSVAKADETRHLVSIRLLRHDNNFGSGHICGGALI 70

  Fly    62 SSNVIVTAAHCLQSVSASVLQIRAGSSY-----------WSSGGVTFSVSSFKNHEGYNANTMVN 115
            :...::||||||.:....  :.|..|.:           ..:|.:...|||......::.::|.:
  Fly    71 APRKVLTAAHCLYNNQRK--RFRRASEFVVVLGTLNRFEHRNGTIVSQVSSMAYMHTFSPDSMRD 133

  Fly   116 DIAIIKINGALTFSS------TIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNI 174
            |:.|:.:...|..|.      |:..|.||......|....|:|||...  .||:.:.|...||:.
  Fly   134 DVGILFLRTGLPMSPGGGVHLTVAPIQLAGQITPPGKLCQVAGWGRTE--QSSLSNILLTANVST 196

  Fly   175 VSQSQCASSTYGYGSQIRSTMICAA--ASGKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPG 237
            :....|...   |.|.:...|:||.  ..|.|:||||||||||..|.||||||||||||....||
  Fly   197 IRHQTCRMI---YRSGLLPGMMCAGRLQGGTDSCQGDSGGPLVHEGRLVGVVSWGYGCAEPGLPG 258

  Fly   238 VYADVAALRSWV 249
            ||.||...|.|:
  Fly   259 VYVDVEYYRQWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 80/244 (33%)
Tryp_SPc 31..252 CDD:238113 80/245 (33%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 80/244 (33%)
Tryp_SPc 33..271 CDD:238113 80/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.