DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and Klk8

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:243 Identity:76/243 - (31%)
Similarity:111/243 - (45%) Gaps:29/243 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHC-------------L 73
            ||......:|:.|......|.|||.:|.:.....|||.:.....::|||||             |
  Rat    24 GLTRAQGSKILEGQECKPHSQPWQTALFQGERLVCGGVLVGDRWVLTAAHCKKDKYSVRLGDHSL 88

  Fly    74 QSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLA 138
            |.......:|:...|....   .|:.|:.::|.        :||.:|::..:......:|.|.||
  Rat    89 QKRDEPEQEIQVARSIQHP---CFNSSNPEDHS--------HDIMLIRLQNSANLGDKVKPIELA 142

  Fly   139 SSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAAS-G 202
            :..|..|....:|||||::....:.|:.|....|.|.||::|..:   |..:|...|:||.:| |
  Rat   143 NLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERA---YPGKITEGMVCAGSSNG 204

  Fly   203 KDACQGDSGGPLVSGGVLVGVVSWGYG-CAYSNYPGVYADVAALRSWV 249
            .|.||||||||||..|||.|:.|||.. |.....||||..:....:|:
  Rat   205 ADTCQGDSGGPLVCNGVLQGITSWGSDPCGKPEKPGVYTKICRYTNWI 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 73/233 (31%)
Tryp_SPc 31..252 CDD:238113 74/234 (32%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4330
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8948
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.