DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and Prss29

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:270 Identity:94/270 - (34%)
Similarity:137/270 - (50%) Gaps:27/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQ------RSGSHSCGGSI 60
            |..:.|.|::| .:..:|||.:|.    .||||::.....:|||:||:      .|..|.|||||
  Rat     7 LTLIFLGSSIA-GIPASVPEDVLV----GIVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSI 66

  Fly    61 YSSNVIVTAAHCLQSVSA--SVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKIN 123
            .....::|||||:....|  |..:|..|..|...|.....||....|..:..:.:.:|:|::::.
  Rat    67 IHPQWVLTAAHCIHESDADPSAFRIYLGQVYLYGGEKLLKVSRVIIHPDFVRSGLGSDVALLQLA 131

  Fly   124 GALTFSSTIKAIGL--ASSNPANGAAASVSGWGTLS-YGSSSIPSQLQYVNVNIVSQSQC----- 180
            .::.....:|.:.|  ||..........|:|||::| :.|...|.:||.|.|.||..:.|     
  Rat   132 QSVRSFPNVKPVKLSPASLEVTKKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYR 196

  Fly   181 -ASSTYGYGSQ-IRSTMICAAASGKDACQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVY 239
             |:....:|.: |...|:||.:.|:|:|.||||||||    ....||||||||||||..:.||||
  Rat   197 NATRLSNHGQRLILQDMLCAGSHGRDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALKDIPGVY 261

  Fly   240 ADVAALRSWV 249
            |.|.....|:
  Rat   262 ARVQFFLPWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 85/240 (35%)
Tryp_SPc 31..252 CDD:238113 86/241 (36%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_117904
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.