DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and KLK13

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_056411.1 Gene:KLK13 / 26085 HGNCID:6361 Length:277 Species:Homo sapiens


Alignment Length:274 Identity:82/274 - (29%)
Similarity:123/274 - (44%) Gaps:41/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKFVILLSAVACALGGTVPE------------GLLPQLDGRIVGGSATTISSFPWQISLQRSGS 53
            |....::::::..||.|.|.:            |.||       ||......|.|||.:|...|.
Human     1 MWPLALVIASLTLALSGGVSQESSKVLNTNGTSGFLP-------GGYTCFPHSQPWQAALLVQGR 58

  Fly    54 HSCGGSIYSSNVIVTAAHCLQSVSASVL------QIRAGSSYWSSGGVTFSVSSFKNHEGYNANT 112
            ..|||.:.....::||||||:......|      ::.||..      |...|.|..:.|...:.|
Human    59 LLCGGVLVHPKWVLTAAHCLKEGLKVYLGKHALGRVEAGEQ------VREVVHSIPHPEYRRSPT 117

  Fly   113 MVN---DIAIIKINGALTFSSTIKAIGLASSNPAN-GAAASVSGWGTLSYGSSSIPSQLQYVNVN 173
            .:|   ||.::::...:..:..|:.:.|:.:|... |....||||||.:....:.|..||..|:.
Human   118 HLNHDHDIMLLELQSPVQLTGYIQTLPLSHNNRLTPGTTCRVSGWGTTTSPQVNYPKTLQCANIQ 182

  Fly   174 IVSQSQCASSTYGYGSQIRSTMICAAA--SGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNY 235
            :.|..:|...   |..:|...|:||..  .|||:|:||||||||....|.|:|||| :.|...:.
Human   183 LRSDEECRQV---YPGKITDNMLCAGTKEGGKDSCEGDSGGPLVCNRTLYGIVSWGDFPCGQPDR 244

  Fly   236 PGVYADVAALRSWV 249
            ||||..|:....|:
Human   245 PGVYTRVSRYVLWI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 73/231 (32%)
Tryp_SPc 31..252 CDD:238113 74/232 (32%)
KLK13NP_056411.1 Tryp_SPc 38..261 CDD:238113 74/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.