DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and TPSG1

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:243 Identity:90/243 - (37%)
Similarity:121/243 - (49%) Gaps:24/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PQLD---GRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQ-SVSASVLQIRA 85
            ||:.   ||||||.|....::|||.||:....|.||||:.|...::|||||.. |:::|..|:..
Human    54 PQVSDAGGRIVGGHAAPAGAWPWQASLRLRRVHVCGGSLLSPQWVLTAAHCFSGSLNSSDYQVHL 118

  Fly    86 G------SSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGL--ASSNP 142
            |      |.::|:.......||.....|.:     .|||:::::..:|.||.|..:.|  ||.:.
Human   119 GELEITLSPHFSTVRQIILHSSPSGQPGTS-----GDIALVELSVPVTLSSRILPVCLPEASDDF 178

  Fly   143 ANGAAASVSGWGTLSYGSS-SIPSQLQYVNVNIVSQSQCASSTYGYGSQI-RSTMICAAASGKDA 205
            ..|....|:|||....|.. ..|..|:.|.|::|....|.....|.|..| :..|:||...| ||
Human   179 CPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARGPG-DA 242

  Fly   206 CQGDSGGPLV----SGGVLVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||.|||||||    ...|..|.||||.||...|.||||..|.|..:|:
Human   243 CQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 86/233 (37%)
Tryp_SPc 31..252 CDD:238113 86/234 (37%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 86/233 (37%)
Tryp_SPc 63..293 CDD:238113 86/234 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 157 1.000 Inparanoid score I4288
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.