DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and KLK5

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001070959.1 Gene:KLK5 / 25818 HGNCID:6366 Length:293 Species:Homo sapiens


Alignment Length:252 Identity:87/252 - (34%)
Similarity:124/252 - (49%) Gaps:27/252 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 TVPEGLLPQL-------------DGRIVGGSATTISSFPWQIS-LQRSGSHSCGGSIYSSNVIVT 68
            |||.|....|             ..||:.||...:.:.|||.: |.|.....||..:.....::|
Human    41 TVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLT 105

  Fly    69 AAHCLQSVSASVLQIRAG----SSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFS 129
            ||||.:    .|.::|.|    |..:.||...|.......|.||:.....||:.:||:|..:..:
Human   106 AAHCRK----KVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPT 166

  Fly   130 STIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRST 194
            ..::.|.::|..|:.|....||||||........|..||.:|::::||.:|..:   |..||..|
Human   167 KDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDA---YPRQIDDT 228

  Fly   195 MICAA-ASGKDACQGDSGGPLVSGGVLVGVVSWG-YGCAYSNYPGVYADVAALRSWV 249
            |.||. .:|:|:||||||||:|..|.|.|:|||| |.||..|.||||.::.....|:
Human   229 MFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWI 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 81/225 (36%)
Tryp_SPc 31..252 CDD:238113 81/226 (36%)
KLK5NP_001070959.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 37..68 6/26 (23%)
Tryp_SPc 66..285 CDD:214473 81/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8473
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.