DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and rab-11.1

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_490675.1 Gene:rab-11.1 / 171601 WormBaseID:WBGene00004274 Length:211 Species:Caenorhabditis elegans


Alignment Length:33 Identity:9/33 - (27%)
Similarity:13/33 - (39%) Gaps:0/33 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 SSNVIVTAAHCLQSVSASVLQIRAGSSYWSSGG 94
            |:||.....:.|..:..||.....|:.....||
 Worm   158 STNVEAAFTNILTEIYKSVSNKHVGTDRQGYGG 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 9/33 (27%)
Tryp_SPc 31..252 CDD:238113 9/33 (27%)
rab-11.1NP_490675.1 PLN03110 5..209 CDD:178657 9/33 (27%)
Rab11_like 9..173 CDD:206660 4/14 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.