DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30025 and PRSS21

DIOPT Version :9

Sequence 1:NP_725036.1 Gene:CG30025 / 246398 FlyBaseID:FBgn0050025 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_006790.1 Gene:PRSS21 / 10942 HGNCID:9485 Length:314 Species:Homo sapiens


Alignment Length:246 Identity:86/246 - (34%)
Similarity:123/246 - (50%) Gaps:25/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVS---------ASVLQ 82
            :..|||||....:..:|||.||:...||.||.|:.|....:|||||.::.|         ....|
Human    38 ITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQ 102

  Fly    83 IRAGSSYWSSGG--VTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASS--NPA 143
            :.:..|:||...  ..:.||:......|..|:.. |||::|::..:|::..|:.|.|.:|  ...
Human   103 LTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPY-DIALVKLSAPVTYTKHIQPICLQASTFEFE 166

  Fly   144 NGAAASVSGWGTLSYGSSSIPS--QLQYVNVNIVSQSQC--ASSTYGYGSQIRSTMICA--AASG 202
            |.....|:|||.:. ...::||  .||.|.|.|::.|.|  ....|.:...|...|:||  |..|
Human   167 NRTDCWVTGWGYIK-EDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGG 230

  Fly   203 KDACQGDSGGPLV--SGGV--LVGVVSWGYGCAYSNYPGVYADVAALRSWV 249
            ||||.|||||||.  ..|:  .:||||||.||...|.||||.:::....|:
Human   231 KDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30025NP_725036.1 Tryp_SPc 30..249 CDD:214473 85/241 (35%)
Tryp_SPc 31..252 CDD:238113 85/242 (35%)
PRSS21NP_006790.1 Tryp_SPc 42..283 CDD:238113 85/242 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.