DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sprt and SLC9A3R2

DIOPT Version :9

Sequence 1:NP_610683.1 Gene:sprt / 246397 FlyBaseID:FBgn0082585 Length:634 Species:Drosophila melanogaster
Sequence 2:XP_016879383.1 Gene:SLC9A3R2 / 9351 HGNCID:11076 Length:372 Species:Homo sapiens


Alignment Length:304 Identity:56/304 - (18%)
Similarity:96/304 - (31%) Gaps:86/304 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 HHPSQQQQQQQQQQQNP-QQNPQQ----------------NPQQTSSNQSQHVTSISISSPPSTP 377
            |||:.|..........| :..||:                :|.:|.:. ..|..::...|..:||
Human   105 HHPAPQSDSAPTSPPIPGEPGPQREVDKWGGSLGRPESSGHPGRTPAT-CCHCAAVMARSGSATP 168

  Fly   378 PEKPLIFQRGNYITTLVGGKPIELMGDDMASTQTPPGHVTKTLIKENTHIDLRDRLSHMYSMPSK 442
            |.:                           :...||....:.|.......:||.||.|:...|  
Human   169 PAR---------------------------APGAPPRSPPQRLDVSGPLRELRPRLCHLRKGP-- 204

  Fly   443 SLSASKISINSDSAYMQHHRRDKERHRDRQHRERPRDPLQQQQQLHREHLMSTHARSVEHLNHYN 507
                        ..|..:...||.|.........|..|..:.....::.|:..:.::||.|.|..
Human   205 ------------QGYGFNLHSDKSRPGQYIRSVDPGSPAARSGLRAQDRLIEVNGQNVEGLRHAE 257

  Fly   508 ---GLDRRRDTPR------QSESNTLRARL-PSDMRSVKSLDFDSENESKP-------ATETRTT 555
               .:..|.|..|      :::.:..|.|: |::......|.....|.:.|       |..:|:.
Human   258 VVASIKAREDEARLLVVDPETDEHFKRLRVTPTEEHVEGPLPSPVTNGTSPAQLNGGSACSSRSD 322

  Fly   556 RPTPPK----KPLRLS------LQRAQSLQTVELHPCADIERKR 589
            .|...|    ..|.||      .::|::::..:..|..|..|||
Human   323 LPGSDKDTEESGLHLSPTAAEAKEKARAMRVNKRAPQMDWNRKR 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sprtNP_610683.1 PDZ <247..288 CDD:294084
SLC9A3R2XP_016879383.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.