DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sprt and lnx1

DIOPT Version :9

Sequence 1:NP_610683.1 Gene:sprt / 246397 FlyBaseID:FBgn0082585 Length:634 Species:Drosophila melanogaster
Sequence 2:XP_005160562.1 Gene:lnx1 / 561226 ZFINID:ZDB-GENE-030131-9439 Length:769 Species:Danio rerio


Alignment Length:422 Identity:90/422 - (21%)
Similarity:147/422 - (34%) Gaps:120/422 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SAHHRAFAKQKSAS-------------MTILNPKGCGSA-----------VKYSLHSTAETNQET 52
            ::|:...|::|..|             :..|..:||.|:           |..:...:.|.|.::
Zfish   147 ASHYGLSAERKRRSQEGDCTDSTSELTLAALPGEGCPSSAIALLSDEPGLVNPAYEPSVEDNSQS 211

  Fly    53 ASTTT-----------------TSTHCSTTGRRRKGGSL-----GGTLSSRSTRSESKELRSALQ 95
            .|||:                 ||....:..|..:..|:     .||..:..|..|...||:|  
Zfish   212 GSTTSLAARSGSRKSEYRNFDRTSVRSRSFRRLNRAFSVLRRTKSGTAVANDTTEERDNLRNA-- 274

  Fly    96 DREAVIQNLRIQLCLGKLPR-----PTG-------------PPLDES-----EKPAAE---QKLN 134
                   |:..:..|..||:     |.|             .||..|     |.|...   |.:.
Zfish   275 -------NIPAEGELFALPQLHHLIPDGEVTSIKITRADPCEPLAISIVGGNETPLVRILIQDIY 332

  Fly   135 RLKTEAENKRIKIKNLKSALEKLDITDNIDIRIRQAELEYALGREELQMLSIVEEARALQARLEK 199
            |....|.:.|:...::...:..:||: |:......|.|:...   .|..|:::.|.|........
Zfish   333 REGVIARDGRLLPGDMILKVNGIDIS-NVPHCYAVAALKQPC---TLLRLTVLREQRHRYRSHHH 393

  Fly   200 SKPEAQTLYNIISSGVSLSLHAV---HATSGRWAVQ--QRTDQPGFYVEWALEG-----DG-LYK 253
            |..||...:.  ::....|||.|   .|...:..::  :|.|:.|.::...|||     || |..
Zfish   394 SPTEAFPAHT--ATIRDDSLHVVLVKRAPDEQLGIKLVRRPDEHGVFIFHLLEGGLAARDGRLRV 456

  Fly   254 GDRILEINGR-LVTGKSKEELQKQVGNSGKCQMVVLRKKSVPIPQKQLDQEKENNMR-------- 309
            .||:|.|||. |..|..:........:..:...:|.|:..:|.|  .:.||...||.        
Zfish   457 DDRVLAINGHDLRYGAPEHAALLIQASEDRVHFIVSRQTHIPAP--DILQEAPWNMEGPPPYSPV 519

  Fly   310 -LQHRI-------SYLEEQVRELQTVKEHHPS 333
             ::|.:       :..|:.|..|   ||.|.|
Zfish   520 DIEHTLLDSCQKPACYEKTVTLL---KEPHDS 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sprtNP_610683.1 PDZ <247..288 CDD:294084 13/47 (28%)
lnx1XP_005160562.1 RING 57..93 CDD:214546
PDZ_signaling 297..381 CDD:238492 16/87 (18%)
PDZ_signaling 411..491 CDD:238492 21/79 (27%)
PDZ_signaling 536..621 CDD:238492 7/16 (44%)
DegQ <548..621 CDD:223343 1/1 (100%)
PDZ_signaling 678..762 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.