DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sprt and grip1

DIOPT Version :9

Sequence 1:NP_610683.1 Gene:sprt / 246397 FlyBaseID:FBgn0082585 Length:634 Species:Drosophila melanogaster
Sequence 2:XP_009298419.1 Gene:grip1 / 558006 ZFINID:ZDB-GENE-041210-125 Length:1191 Species:Danio rerio


Alignment Length:303 Identity:59/303 - (19%)
Similarity:115/303 - (37%) Gaps:90/303 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 ETNQETASTTTTS------------THCSTTGR------RRKGGSLGGTLSSRSTRSESKELRSA 93
            ||||....::.||            :...::|.      ::.|..||.|:||.|:|.....|   
Zfish   559 ETNQLLRDSSITSKVTLEIEFDVAESVIPSSGTFHVKLPKKPGVELGITISSPSSRKPGDAL--- 620

  Fly    94 LQDREAVIQNLRIQLCLGKLPRPTGPPLDESEKPAAEQKLNRLKTEAENKRIKIKNLKSALEKLD 158
                  :|.:::    .|.:...||                  ..|..:|.:.|.|::  |:...
Zfish   621 ------IISDIK----KGSVAHRTG------------------TLELGDKLLAIDNIR--LDNCS 655

  Fly   159 ITDNIDIRIRQAE--LEYALGREE-----LQMLSIVEEARALQARL-EKSKPEAQTLYNIISS-- 213
            :.|.:.| ::|.|  ::..:.::|     |:..|:...||.|.|.: ::.:.....:|.:...  
Zfish   656 MEDAVQI-LQQCEDLVKLKIRKDEDNSGVLRAGSVDRNARVLLACVADEQETSGAIIYTVELKRY 719

  Fly   214 ----GVSLS--------LHAVHATSGRWAVQQRTDQPGFYVEWALEGDGLYKGDRILEINGRLVT 266
                |:::|        :.....|.|  .:.:||             ..::.|||||.||...:.
Zfish   720 GGPLGITISGTEEPFDPIIISSLTKG--GLAERT-------------GAIHIGDRILAINSNSLK 769

  Fly   267 GKSKEELQKQVGNSGKCQMVVLRKK-SVPIPQKQLDQEKENNM 308
            ||...|....:..:|:...:.::|: .:|.|:......:.||:
Zfish   770 GKPLSEAIHLLQMAGESVTLKIKKQGELPSPKPPSVTGRLNNL 812

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sprtNP_610683.1 PDZ <247..288 CDD:294084 11/40 (28%)
grip1XP_009298419.1 PDZ_signaling 79..159 CDD:238492
PDZ_signaling 178..261 CDD:238492
PDZ_signaling 276..359 CDD:238492
PDZ_signaling 490..578 CDD:238492 6/18 (33%)
PDZ_signaling 591..675 CDD:238492 22/117 (19%)
PDZ_signaling 711..792 CDD:238492 18/95 (19%)
PDZ_signaling 1053..1133 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.