DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sprt and Zasp67

DIOPT Version :9

Sequence 1:NP_610683.1 Gene:sprt / 246397 FlyBaseID:FBgn0082585 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_648358.2 Gene:Zasp67 / 39148 FlyBaseID:FBgn0036044 Length:730 Species:Drosophila melanogaster


Alignment Length:344 Identity:69/344 - (20%)
Similarity:126/344 - (36%) Gaps:106/344 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 PIPQKQLDQEKENNMRLQHRISYLEEQVRELQTVKEHHPSQQQ-----------------QQQQQ 341
            |:|.|     .|..:.|:.:::.::.|:..|.::    ||..|                 :.|||
  Fly   434 PVPVK-----SEEELALERQLADVQRQLAALSSL----PSTIQSTLDAVTKQLADLLPTIKLQQQ 489

  Fly   342 QQQNPQQNPQQNPQQTSSNQSQHVTSISISSPPSTPPEKPLIFQRGNYITTL----VGGKPIELM 402
            ::|.||.:      :.|.|:.|....::.::               |.|.|.    ..||.|.:.
  Fly   490 EKQLPQID------ENSGNEEQVEEGVTTAT---------------NTINTAGETEDAGKDISIS 533

  Fly   403 GDDMASTQTPPGHVTKTLIKENTHIDLRDRLSHMYSMPSKSLSASKISINSDSAYMQHHRRDKER 467
            |.|     .||....::   .....|..||            ..::||.::|...:   .:||::
  Fly   534 GSD-----NPPVGPCES---NEDRCDANDR------------EVAEISRSTDDNRL---AKDKKK 575

  Fly   468 HRD---RQHRERPRDPLQQQQQLHREHLMSTHARSVEHLNHYNGLDRRRDTPRQSE--------S 521
            ..|   :|.:::.::||.::|...::..........|||       .|::.||:|:        |
  Fly   576 DLDQEQKQQQQQQQEPLSEEQNFKKQKRHDVIEELEEHL-------VRKNNPRRSKRAFGPLVPS 633

  Fly   522 NTLRARLPSDMRSVKSLD-----FDSENESKPAT----ETRTTRPTPPKKPLR-LSLQRAQSLQT 576
            :.....||...|..:..|     |.:|..|..|.    .|........:||.| :.|.|::..:.
  Fly   634 SERPLVLPGGRRWYRPKDAYNDEFIAETLSAQAELITGSTLGVNFMKYQKPERKIDLNRSEVYKY 698

  Fly   577 VELH----PCADIERKRPM 591
            :..|    |...||.:.|:
  Fly   699 LNPHLDRAPVRGIEVRAPL 717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sprtNP_610683.1 PDZ <247..288 CDD:294084
Zasp67NP_648358.2 PDZ_signaling 2..75 CDD:238492
DUF4749 653..>699 CDD:292558 10/45 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.