DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sprt and gopc

DIOPT Version :9

Sequence 1:NP_610683.1 Gene:sprt / 246397 FlyBaseID:FBgn0082585 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_956851.1 Gene:gopc / 326887 ZFINID:ZDB-GENE-030131-5086 Length:455 Species:Danio rerio


Alignment Length:341 Identity:72/341 - (21%)
Similarity:116/341 - (34%) Gaps:117/341 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 ELRSALQD------------REAVIQNLRIQLCLGKLPRPTG--------------PPLDESEK- 126
            :|||.|.|            .|.::|...:||   ||....|              |.::|.|| 
Zfish    99 DLRSELTDVQAEKVVVEKEVHEQLLQLHAMQL---KLQAKGGQAVDSDSIKDRMPVPSVEEKEKE 160

  Fly   127 --PAAEQKLNRLKTEAENKRIKIKN----------------LKSALEKLDITDNIDIRIRQAELE 173
              .:.::|:..:|.|||.|.:|.:|                .:.|.:.||  ..:..|::|.:| 
Zfish   161 LEASKKEKVKEVKLEAEVKMLKKENEALRRHIAVLQAEVYGARLAAKYLD--KELAGRVQQIQL- 222

  Fly   174 YALGRE---------------ELQMLSIVEEARALQARLEKSKPEAQTLYNIISSGVSLSLHAVH 223
              |||:               |:.:.......||.:.|.:..||        :.|.|.....::.
Zfish   223 --LGRDMKGPAHDKLWNQLEAEIHLHRHKTVIRACRGRNDPKKP--------LPSPVGHDTDSLK 277

  Fly   224 ATSG----RWAVQQRTDQPGFYVEWALEG----------------------DGLYKGDRILEING 262
            .|.|    |..|..:.|..|..:  ::.|                      .||:.||.||.:|.
Zfish   278 KTQGVGPIRKVVLTKEDHEGLGI--SITGGKEHGVPILISEIHPTQPAERCGGLHVGDAILAVNN 340

  Fly   263 -RLVTGKSKEELQKQVGNSGKCQM-VVLRKKSVPIPQKQLDQEKENNMRLQHRISYLEE------ 319
             .|...|.||.:.......|:.:. ||.....|....:.::.|.::..|.:..:..|||      
Zfish   341 INLRDAKHKEAVTILSQQRGEIEFEVVYVAPEVDSDDENVEYEDDSGHRYRLYLDELEEASAANH 405

  Fly   320 -----QVRELQTVKEH 330
                 ....||.|.:|
Zfish   406 NNGTADPASLQAVGKH 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sprtNP_610683.1 PDZ <247..288 CDD:294084 14/64 (22%)
gopcNP_956851.1 PDZ_signaling 285..367 CDD:238492 17/83 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.