DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sprt and Cytip

DIOPT Version :9

Sequence 1:NP_610683.1 Gene:sprt / 246397 FlyBaseID:FBgn0082585 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001012086.1 Gene:Cytip / 311047 RGDID:1307990 Length:359 Species:Rattus norvegicus


Alignment Length:273 Identity:53/273 - (19%)
Similarity:92/273 - (33%) Gaps:93/273 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 LRSALQDREAVIQNLRIQLC----LGKLPRPTGPPLDESEKPAAEQKLNRLKTEAENKRIKIKNL 150
            |:..||.:.:   |..::.|    ....|..|||                 .|..:|:||::   
  Rat     3 LQRLLQQQSS---NGNLEYCADSAYSSYPTLTGP-----------------LTVEDNRRIQM--- 44

  Fly   151 KSALEKLDITDNIDIRIRQAELEYALGREELQML--SIVEEARALQAR---LEKSKP-----EAQ 205
                    :.|.:....|        ||::|.:.  |.:.:....|.:   :||...     |.|
  Rat    45 --------LADTVATLPR--------GRKQLALARSSSLGDFSCSQRKVVTVEKQDNGTFGFEIQ 93

  Fly   206 TL----YNIISSGVSLSLHAVHATSGRWAVQQRTDQPGFYVEWALEGDGLYKGDRILEINGRLVT 266
            |.    .||.||.|...:..|           :.|.|....       ||..||....:||....
  Rat    94 TYRLQNQNICSSEVCTMICKV-----------QEDSPAHCA-------GLQVGDIFANVNGVSTE 140

  Fly   267 GKSKEELQKQVGNSGKCQMVVLRKKSVPIPQKQLDQEKENNMRLQHRISYLEEQVREL-QTVKEH 330
            |.:.:::...:.:||....:                 :..|..:.||.:.||.:::.| ||:|:.
  Rat   141 GFTHKQVVDLIRSSGNLLTI-----------------ETLNGTMIHRRAELEAKLQTLKQTLKKK 188

  Fly   331 HPSQQQQQQQQQQ 343
            ....:....|:|:
  Rat   189 WVELRSLHLQEQR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sprtNP_610683.1 PDZ <247..288 CDD:294084 9/40 (23%)
CytipNP_001012086.1 PDZ_signaling 76..161 CDD:238492 22/119 (18%)
Interaction with CYTH1. /evidence=ECO:0000250 166..188 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.