DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sprt and Cytip

DIOPT Version :9

Sequence 1:NP_610683.1 Gene:sprt / 246397 FlyBaseID:FBgn0082585 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_631939.1 Gene:Cytip / 227929 MGIID:2183535 Length:359 Species:Mus musculus


Alignment Length:439 Identity:77/439 - (17%)
Similarity:135/439 - (30%) Gaps:144/439 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 TEAENKRIKIKNLKSALEKLDITDNIDIRIRQAELEYALGREELQM-----LSIVEEARALQARL 197
            |..:|:||::           :.|.:....|        ||::|.:     |.....::.....:
Mouse    35 TMEDNRRIQV-----------LADTVATLPR--------GRKQLALARSSSLGDFSWSQRKVVTV 80

  Fly   198 EKSKP-----EAQTL----YNIISSGVSLSLHAVHATSGRWAVQQRTDQPGFYVEWALEGDGLYK 253
            ||...     |.||.    .||.||.|...:..|           :.|.|....       ||..
Mouse    81 EKQDNGTFGFEIQTYRLQNQNICSSEVCTMICKV-----------QEDSPAHCA-------GLQV 127

  Fly   254 GDRILEINGRLVTGKSKEELQKQVGNSGKCQMVVLRKKSVPIPQKQLDQEKENNMRLQHRISYLE 318
            ||....:||....|.:.:::...:.:||....:                 :..|..:.||.:.||
Mouse   128 GDIFANVNGVSTEGFTHKQVVDLIRSSGNLLTI-----------------ETLNGTMIHRRAELE 175

  Fly   319 EQVREL-QTVKEHHPSQQQQQQQQQQQNPQQNPQQNPQQTSSNQSQHVTSISISSPPSTPPEKPL 382
            .:::.| ||:|:.....:....|:|:                        :......::|..:.:
Mouse   176 AKLQTLKQTLKKKWVELRSLHLQEQR------------------------LLHGDTANSPNLENM 216

  Fly   383 IFQRGNYITTLVGGKPIELMGDDMASTQTPPGHVTKTLIKENTHIDLRDRLSHMYSMPSKSLS-A 446
            .....:....|:|..|.                             |.||  |..|..|...| .
Mouse   217 DLDESSLFGNLLGPSPA-----------------------------LLDR--HRLSSESSCKSWL 250

  Fly   447 SKISINSDSAYMQHHRRDKERHR--------DRQHRERPRDPLQQQQQLHREHLMS-THARSVEH 502
            |.::::|:..|......|..|..        |.....:..|.:.:.....|...:| |.:.|...
Mouse   251 SSLTVDSEDGYRSSMSEDSIRGAFSRQTSTDDECFHSKDGDEILRNASSRRNRSISVTSSGSFSP 315

  Fly   503 LNHYNGLDRRRDTPRQSESNTLRAR----LPSDMRSVKSLDFDSENESK 547
            |...|........||:|...::|.:    :|...|:|:      |.||:
Mouse   316 LWESNYSSVFGTLPRKSRRGSVRKQILKFIPGLHRAVE------EEESR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sprtNP_610683.1 PDZ <247..288 CDD:294084 9/40 (23%)
CytipNP_631939.1 PDZ_signaling 76..161 CDD:238492 22/119 (18%)
Interaction with CYTH1. /evidence=ECO:0000250 166..188 8/21 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.