powered by:
Protein Alignment sprt and txt-1
DIOPT Version :9
Sequence 1: | NP_610683.1 |
Gene: | sprt / 246397 |
FlyBaseID: | FBgn0082585 |
Length: | 634 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493661.1 |
Gene: | txt-1 / 183651 |
WormBaseID: | WBGene00016807 |
Length: | 152 |
Species: | Caenorhabditis elegans |
Alignment Length: | 72 |
Identity: | 18/72 - (25%) |
Similarity: | 42/72 - (58%) |
Gaps: | 6/72 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 250 GLYK-GDRILEINGRLVTGK--SKEELQKQVGNSGKCQMVVLRKK---SVPIPQKQLDQEKENNM 308
|:.| ||:|:|||.:.|..| .|:.|.:.:.:.|:..::::|.| :|.:.::::...::.:.
Worm 81 GVLKYGDQIIEINKKNVLNKIDCKKRLMQCLKDKGQVDIIIVRPKTADAVTMIEQEIQLSQQPST 145
Fly 309 RLQHRIS 315
..|.:|:
Worm 146 TAQPKIN 152
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.