DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sprt and SYNJ2BP-COX16

DIOPT Version :9

Sequence 1:NP_610683.1 Gene:sprt / 246397 FlyBaseID:FBgn0082585 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_001189476.1 Gene:SYNJ2BP-COX16 / 100529257 HGNCID:48350 Length:191 Species:Homo sapiens


Alignment Length:187 Identity:37/187 - (19%)
Similarity:74/187 - (39%) Gaps:57/187 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 NIISSGVSLSLHAVHATSGRWAVQQRTDQPGFYVEWALEG-----DG-LYKGDRILEINGR---- 263
            |:......|..:.|..|..::.    ::..|.||....|.     || |.:||:||.:||:    
Human    15 NLTRGPSGLGFNIVGGTDQQYV----SNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKN 75

  Fly   264 ---------------LVTGKSKEELQKQ---VGNSGKCQ-------MVVLRKKSVPIPQKQLDQE 303
                           .|:.:.:..||.|   :|:.|:..       ||::...::.:...:|:::
Human    76 LLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMMDPELEKK 140

  Fly   304 -KENNMRLQHRISYLEEQVRELQTVKEHHPSQQQQQQQQQQQNPQQNPQ----QNPQ 355
             |||.:.|:          .|.:.:|:   |:....:..:...|.::|.    :||:
Human   141 LKENKISLE----------SEYEKIKD---SKFDDWKNIRGPRPWEDPDLLQGRNPE 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sprtNP_610683.1 PDZ <247..288 CDD:294084 18/75 (24%)
SYNJ2BP-COX16NP_001189476.1 PDZ_signaling 13..97 CDD:238492 18/85 (21%)
DegQ <16..77 CDD:223343 16/64 (25%)
COX16 <133..173 CDD:290843 9/52 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.