DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mthl13 and ADGRG2

DIOPT Version :10

Sequence 1:NP_788325.2 Gene:mthl13 / 246395 FlyBaseID:FBgn0050018 Length:440 Species:Drosophila melanogaster
Sequence 2:XP_047297711.1 Gene:ADGRG2 / 10149 HGNCID:4516 Length:1055 Species:Homo sapiens


Alignment Length:129 Identity:29/129 - (22%)
Similarity:50/129 - (38%) Gaps:34/129 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEDETMFGEKQSIRDSARSLKKYGSISGGSRSPAALQPTDALIRHDVERTDTLQGLALKYGCSME 65
            |..:.:||..:.||.:..:|           .|.|.:|..::...||.|.:.  ||. :.|.||:
Human     3 MVSKDLFGTGKLIRAADLTL-----------GPEACEPLVSMDTEDVVRFEV--GLH-ECGNSMQ 53

  Fly    66 QIRRVNRLLPTDTIFLRPFLMVPVAKDSPHYPKDPE--AIIRPN--ALTSASRMPSGGSASTSS 125
                    :..|.:....||:        |.|:...  :|:|.|  .:....|.|..|:.|:.:
Human    54 --------VTDDALVYSTFLL--------HDPRPVGNLSIVRTNRAEIPIECRYPRQGNVSSQA 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mthl13NP_788325.2 Mth_Ecto <49..158 CDD:448329 18/81 (22%)
7tm_GPCRs 186..440 CDD:475119
TM helix 2 197..218 CDD:410628
TM helix 3 227..249 CDD:410628
TM helix 4 269..285 CDD:410628
TM helix 5 316..339 CDD:410628
TM helix 6 376..397 CDD:410628
TM helix 7 402..431 CDD:410628
ADGRG2XP_047297711.1 PHA03247 <285..458 CDD:223021
GPS 605..655 CDD:197639
7tmB2_GPR64 663..932 CDD:320560
TM helix 1 665..690 CDD:320560
TM helix 2 700..722 CDD:320560
TM helix 3 733..760 CDD:320560
TM helix 4 775..791 CDD:320560
TM helix 5 821..844 CDD:320560
TM helix 6 867..892 CDD:320560
TM helix 7 896..921 CDD:320560
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.