DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30016 and Urah

DIOPT Version :9

Sequence 1:NP_724982.1 Gene:CG30016 / 246393 FlyBaseID:FBgn0050016 Length:113 Species:Drosophila melanogaster
Sequence 2:XP_030098952.1 Gene:Urah / 76974 MGIID:1916142 Length:177 Species:Mus musculus


Alignment Length:128 Identity:43/128 - (33%)
Similarity:65/128 - (50%) Gaps:17/128 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DARKFSTHILDTSVGKAAANVRVTVSRLD-EIQEWRSLRAAQTDADGRCL-LLEPGQFPGGIYKL 64
            ::...:||:|||:.|..|..:.:.:|||: ..|:|..||.:.|:.||||. ||.|.|...|.|||
Mouse    27 ESSPLTTHVLDTASGLPAQGLCLRLSRLEAPCQQWMELRTSYTNLDGRCPGLLTPSQIKPGTYKL 91

  Fly    65 TFHVGAYYAERNVRTLYPAID----LIVDCSEN------QNYHI-----PLLLNPFGYSTYRG 112
            .|....|:.||...:.||.::    |...|.|:      :.:|:     |.||...|:..|:|
Mouse    92 FFDTERYWKERGQESFYPYVEPAWHLTSCCLEDPGAIAGRTHHLQCLQEPSLLLTGGFHYYKG 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30016NP_724982.1 Transthyretin 7..112 CDD:376352 42/121 (35%)
UrahXP_030098952.1 Peptidase_M14NE-CP-C_like 29..>112 CDD:389755 33/82 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830656
Domainoid 1 1.000 91 1.000 Domainoid score I7707
eggNOG 1 0.900 - - E1_COG2351
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45975
Inparanoid 1 1.050 91 1.000 Inparanoid score I5096
Isobase 1 0.950 - 0 Normalized mean entropy S4186
OMA 1 1.010 - - QHG63234
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003922
OrthoInspector 1 1.000 - - oto92387
orthoMCL 1 0.900 - - OOG6_104182
Panther 1 1.100 - - LDO PTHR10395
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R562
SonicParanoid 1 1.000 - - X3225
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.