DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30016 and uraha

DIOPT Version :9

Sequence 1:NP_724982.1 Gene:CG30016 / 246393 FlyBaseID:FBgn0050016 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001038917.2 Gene:uraha / 751742 ZFINID:ZDB-GENE-060825-253 Length:138 Species:Danio rerio


Alignment Length:114 Identity:42/114 - (36%)
Similarity:63/114 - (55%) Gaps:11/114 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 STHILDTSVGKAAANVRVTVSRLDEIQE-WRSLRAAQTDADGRCLLLEPG-----QFPGGIYKLT 65
            |||:|:.:.|...||:.:.:.|||.:.. |..|....|:.||||    ||     .|..|:||:.
Zfish    29 STHVLNIAQGVPGANMTIVLHRLDPVSSAWNILTTGITNDDGRC----PGLITKENFIAGVYKMR 89

  Fly    66 FHVGAYYAERNVRTLYPAIDLIVDCSE-NQNYHIPLLLNPFGYSTYRGT 113
            |..|.|:........||.::::...:. :|:||:||||:.|.||||||:
Zfish    90 FETGKYWDALGETCFYPYVEIVFTITNTSQHYHVPLLLSRFSYSTYRGS 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30016NP_724982.1 Transthyretin 7..112 CDD:376352 40/111 (36%)
urahaNP_001038917.2 Transthyretin_like 26..138 CDD:100112 41/112 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573398
Domainoid 1 1.000 81 1.000 Domainoid score I8447
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45975
Inparanoid 1 1.050 81 1.000 Inparanoid score I5191
OMA 1 1.010 - - QHG63234
OrthoDB 1 1.010 - - D1453185at2759
OrthoFinder 1 1.000 - - FOG0003922
OrthoInspector 1 1.000 - - otm26128
orthoMCL 1 0.900 - - OOG6_104182
Panther 1 1.100 - - LDO PTHR10395
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R562
SonicParanoid 1 1.000 - - X3225
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.