DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30016 and urahb

DIOPT Version :9

Sequence 1:NP_724982.1 Gene:CG30016 / 246393 FlyBaseID:FBgn0050016 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001186950.2 Gene:urahb / 570474 ZFINID:ZDB-GENE-161215-1 Length:120 Species:Danio rerio


Alignment Length:115 Identity:39/115 - (33%)
Similarity:63/115 - (54%) Gaps:3/115 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DARKFSTHILDTSVGKAAANVRVTVSRLD-EIQEWRSLRAAQTDADGRCL-LLEPGQFPGGIYKL 64
            |....|||:|:|..|..|..:.:::.||: .|..|..:....|:.||||. |:....|..|:||:
Zfish     6 DISPLSTHVLNTGDGVPAQRMTLSLHRLEPRITVWSLVTVGSTNEDGRCPGLISRDAFTPGMYKM 70

  Fly    65 TFHVGAYYAERNVRTLYPAIDLIVDCSE-NQNYHIPLLLNPFGYSTYRGT 113
            .|....|:......:.||.:::|...:: :|..|:|||::.|.||||||:
Zfish    71 RFETQQYWESLGQSSFYPYVEIIFTITDVDQRLHVPLLISRFSYSTYRGS 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30016NP_724982.1 Transthyretin 7..112 CDD:376352 36/107 (34%)
urahbNP_001186950.2 Transthyretin 9..119 CDD:278973 36/109 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573399
Domainoid 1 1.000 81 1.000 Domainoid score I8447
eggNOG 1 0.900 - - E1_COG2351
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45975
Inparanoid 1 1.050 81 1.000 Inparanoid score I5191
OMA 1 1.010 - - QHG63234
OrthoDB 1 1.010 - - D1453185at2759
OrthoFinder 1 1.000 - - FOG0003922
OrthoInspector 1 1.000 - - otm26128
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10395
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R562
SonicParanoid 1 1.000 - - X3225
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.900

Return to query results.
Submit another query.