DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30016 and ttr

DIOPT Version :9

Sequence 1:NP_724982.1 Gene:CG30016 / 246393 FlyBaseID:FBgn0050016 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001005598.2 Gene:ttr / 449556 ZFINID:ZDB-GENE-040927-14 Length:149 Species:Danio rerio


Alignment Length:103 Identity:26/103 - (25%)
Similarity:49/103 - (47%) Gaps:3/103 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILDTSVGKAAANVRVTVSRLDEIQEWRSLRAAQTDADGRC-LLLEPGQFPGGIYKLTFHVGAYYA 73
            |||...|..|.|:.:.:.|.|:...|..:.:.:.|..|.. .|:...:|..|:|::.|....|:.
Zfish    38 ILDAVKGTPAGNIALDLFRQDQGGTWEKIASGKVDMTGEVHNLITEQEFTPGVYRVEFDTLTYWK 102

  Fly    74 ERNVRTLYPAIDLIVD--CSENQNYHIPLLLNPFGYST 109
            .......:...|::.:  ...:::|.:.|||:||.|:|
Zfish   103 TEGRTPFHQLADVVFEAHAEGHRHYTLALLLSPFSYTT 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30016NP_724982.1 Transthyretin 7..112 CDD:376352 26/103 (25%)
ttrNP_001005598.2 Peptidase_M14NE-CP-C_like 26..144 CDD:304370 26/103 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573397
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2351
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1453185at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10395
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R562
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.