DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30016 and RGD1309350

DIOPT Version :9

Sequence 1:NP_724982.1 Gene:CG30016 / 246393 FlyBaseID:FBgn0050016 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_001127979.1 Gene:RGD1309350 / 293613 RGDID:1309350 Length:141 Species:Rattus norvegicus


Alignment Length:115 Identity:44/115 - (38%)
Similarity:70/115 - (60%) Gaps:3/115 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DARKFSTHILDTSVGKAAANVRVTVSRLD-EIQEWRSLRAAQTDADGRCL-LLEPGQFPGGIYKL 64
            ::...:||:|||:.|..|..:.:.:.||: ..|:|..||.:.|:.||||. ||...|...|.|||
  Rat    27 ESSPLTTHVLDTASGLPAQGLCLRLCRLEAPSQQWMELRTSYTNLDGRCPGLLTQSQMKPGTYKL 91

  Fly    65 TFHVGAYYAERNVRTLYPAIDLIVDCS-ENQNYHIPLLLNPFGYSTYRGT 113
            :|....|:.||...:.||.::::...: |.|.:|:||||:|:.|:||||:
  Rat    92 SFDTERYWKERGQESFYPYVEVVFTITKETQKFHVPLLLSPWSYTTYRGS 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30016NP_724982.1 Transthyretin 7..112 CDD:376352 42/107 (39%)
RGD1309350NP_001127979.1 TLP_HIUase 29..141 CDD:100114 43/111 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334373
Domainoid 1 1.000 86 1.000 Domainoid score I7972
eggNOG 1 0.900 - - E1_COG2351
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45975
Inparanoid 1 1.050 87 1.000 Inparanoid score I5059
OMA 1 1.010 - - QHG63234
OrthoDB 1 1.010 - - D1453185at2759
OrthoFinder 1 1.000 - - FOG0003922
OrthoInspector 1 1.000 - - oto95954
orthoMCL 1 0.900 - - OOG6_104182
Panther 1 1.100 - - LDO PTHR10395
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3225
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.