DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30016 and SPCC285.04

DIOPT Version :9

Sequence 1:NP_724982.1 Gene:CG30016 / 246393 FlyBaseID:FBgn0050016 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_588333.1 Gene:SPCC285.04 / 2539256 PomBaseID:SPCC285.04 Length:124 Species:Schizosaccharomyces pombe


Alignment Length:111 Identity:41/111 - (36%)
Similarity:65/111 - (58%) Gaps:4/111 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 STHILDTSVGKAAANVRVTVSRLDE--IQEWRSLRAAQTDADGRCLL--LEPGQFPGGIYKLTFH 67
            :.|||:|..|..||.|:|.:.:|:|  ....:.:...:|:|:||...  ::......|||...|.
pombe    14 TAHILNTMSGIPAAGVQVALFKLNESPTPSQQFIATTETNANGRVTSWNVDLSTVESGIYTFRFE 78

  Fly    68 VGAYYAERNVRTLYPAIDLIVDCSENQNYHIPLLLNPFGYSTYRGT 113
            .|||:....|.:.||.:::.|..::.|:|||||||.|:||:||||:
pombe    79 TGAYFDSLGVTSFYPYVEMAVRINKGQHYHIPLLLAPYGYTTYRGS 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30016NP_724982.1 Transthyretin 7..112 CDD:376352 39/108 (36%)
SPCC285.04NP_588333.1 Peptidase_M14NE-CP-C_like 2..124 CDD:304370 40/109 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 77 1.000 Domainoid score I2441
eggNOG 1 0.900 - - E1_COG2351
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1881
OMA 1 1.010 - - QHG63234
OrthoFinder 1 1.000 - - FOG0003922
OrthoInspector 1 1.000 - - oto100693
orthoMCL 1 0.900 - - OOG6_104182
Panther 1 1.100 - - LDO PTHR10395
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R562
SonicParanoid 1 1.000 - - X3225
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.