DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30016 and Ttr

DIOPT Version :9

Sequence 1:NP_724982.1 Gene:CG30016 / 246393 FlyBaseID:FBgn0050016 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_038725.1 Gene:Ttr / 22139 MGIID:98865 Length:147 Species:Mus musculus


Alignment Length:103 Identity:24/103 - (23%)
Similarity:46/103 - (44%) Gaps:3/103 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILDTSVGKAAANVRVTVSRLDEIQEWRSLRAAQTDADGRCL-LLEPGQFPGGIYKLTFHVGAYYA 73
            :||...|..|.:|.|.|.:......|....:.:|...|... |....:|..|:|::.....:|:.
Mouse    36 VLDAVRGSPAVDVAVKVFKKTSEGSWEPFASGKTAESGELHGLTTDEKFVEGVYRVELDTKSYWK 100

  Fly    74 ERNVRTLYPAIDLIVDCSE--NQNYHIPLLLNPFGYST 109
            ...:...:...|::...::  :::|.|..||:|:.|||
Mouse   101 TLGISPFHEFADVVFTANDSGHRHYTIAALLSPYSYST 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30016NP_724982.1 Transthyretin 7..112 CDD:376352 24/103 (23%)
TtrNP_038725.1 TR_THY 27..147 CDD:128406 24/103 (23%)
Thyroid hormone binding. /evidence=ECO:0000250 135..139 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167830655
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2351
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1453185at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10395
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R562
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.840

Return to query results.
Submit another query.