DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30016 and ZK697.8

DIOPT Version :9

Sequence 1:NP_724982.1 Gene:CG30016 / 246393 FlyBaseID:FBgn0050016 Length:113 Species:Drosophila melanogaster
Sequence 2:NP_503496.2 Gene:ZK697.8 / 191414 WormBaseID:WBGene00022808 Length:136 Species:Caenorhabditis elegans


Alignment Length:110 Identity:37/110 - (33%)
Similarity:61/110 - (55%) Gaps:5/110 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 STHILDTSVGKAAANVRVTVSRLDEIQEWRSLRAAQTDADGRCLLLEPG--QFPGGIYKLTFHVG 69
            |.|:||.|.|..|..:::....|.. ..|.::.:..|..:||...:.|.  ..| |.|:|.:...
 Worm    29 SAHVLDISGGSPAGGIQILAFILLN-NGWTNIGSQFTQDNGRVDWVSPDFTLIP-GTYRLVYITE 91

  Fly    70 AYYAERNVRTLYPAIDLIVDC-SENQNYHIPLLLNPFGYSTYRGT 113
            .||..:||.:.||.::::.:. :..|:||:||.|:|:|||||||:
 Worm    92 PYYTAKNVESFYPYVEVVFNIRNATQHYHVPLTLSPWGYSTYRGS 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30016NP_724982.1 Transthyretin 7..112 CDD:376352 35/107 (33%)
ZK697.8NP_503496.2 TLP_HIUase 28..136 CDD:100114 36/108 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156067
Domainoid 1 1.000 71 1.000 Domainoid score I6146
eggNOG 1 0.900 - - E1_COG2351
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H45975
Inparanoid 1 1.050 72 1.000 Inparanoid score I3890
Isobase 1 0.950 - 0 Normalized mean entropy S4186
OMA 1 1.010 - - QHG63234
OrthoDB 1 1.010 - - D1453185at2759
OrthoFinder 1 1.000 - - FOG0003922
OrthoInspector 1 1.000 - - otm14225
orthoMCL 1 0.900 - - OOG6_104182
Panther 1 1.100 - - LDO PTHR10395
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R562
SonicParanoid 1 1.000 - - X3225
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1817.750

Return to query results.
Submit another query.