DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30010 and si:ch1073-287p18.1

DIOPT Version :9

Sequence 1:NP_001260836.2 Gene:CG30010 / 246389 FlyBaseID:FBgn0050010 Length:215 Species:Drosophila melanogaster
Sequence 2:XP_009293291.1 Gene:si:ch1073-287p18.1 / 556730 ZFINID:ZDB-GENE-081104-80 Length:216 Species:Danio rerio


Alignment Length:206 Identity:107/206 - (51%)
Similarity:140/206 - (67%) Gaps:9/206 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FVRSPSISCRYV-QYNQGQSPEPKIREYFYYIDHEGMLFLDDAKMKNFTSCFKEKDFLKFFFNRL 77
            |.|...:.||.| .|.||||||.:||||||||||:|.|||||.|:|||.:|||::.||.|||:||
Zfish     8 FSRQCGLFCRNVSSYTQGQSPEARIREYFYYIDHQGQLFLDDTKVKNFVTCFKDQHFLVFFFSRL 72

  Fly    78 RLNKTSRYESEFPYISLCGRERNFIRCDDTPVVFTEQLRKDDTE-VLSYAHAGQVLTLPYEPHKL 141
            ::|::.||:.:||::|||||||||:||:|.|:|||....:...| .|||...|..|::|:.|..|
Zfish    73 KVNQSGRYQQDFPFVSLCGRERNFLRCEDQPIVFTHLFSEVGLEDRLSYCGGGAKLSVPFRPQSL 137

  Fly   142 YMDPRNGRVYHPAAPQVGGIGLVRSKLAIELSQHFEFLAGE----ASPTHFQWNGERLELQNEWV 202
            :|.|.:||||||...:.||.||:||.||||:|.||.:..|:    |.||||.|.|.|..|..|. 
Zfish   138 FMHPDSGRVYHPGPERTGGAGLLRSALAIEISAHFGYDTGQDGTAAQPTHFTWAGRRHALSKEL- 201

  Fly   203 NNTQRFPMNED 213
              .:.||:.:|
Zfish   202 --EKHFPVQKD 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30010NP_001260836.2 DUF4505 29..201 CDD:405623 97/176 (55%)
si:ch1073-287p18.1XP_009293291.1 DUF4505 21..201 CDD:291617 98/179 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 173 1.000 Domainoid score I3657
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 175 1.000 Inparanoid score I4055
OMA 1 1.010 - - QHG49130
OrthoDB 1 1.010 - - D1570646at2759
OrthoFinder 1 1.000 - - FOG0007166
OrthoInspector 1 1.000 - - oto41450
orthoMCL 1 0.900 - - OOG6_105754
Panther 1 1.100 - - LDO PTHR31449
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2873
SonicParanoid 1 1.000 - - X5276
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.