DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30010 and MGC94207

DIOPT Version :9

Sequence 1:NP_001260836.2 Gene:CG30010 / 246389 FlyBaseID:FBgn0050010 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001007752.1 Gene:MGC94207 / 362946 RGDID:1359663 Length:218 Species:Rattus norvegicus


Alignment Length:200 Identity:108/200 - (54%)
Similarity:135/200 - (67%) Gaps:12/200 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLTNLKFVRSPSISCR------YVQYNQGQSPEPKIREYFYYIDHEGMLFLDDAKMKNFTSCFKE 66
            ::.||..|.:.|...|      .|.|.|||||||:.||||||:||:|.|||||:|||||.:|||:
  Rat     7 AMRNLALVLARSQRARACSGNERVSYTQGQSPEPRTREYFYYVDHQGQLFLDDSKMKNFITCFKD 71

  Fly    67 KDFLKFFFNRLRLNKTSRYESEFPYISLCGRERNFIRCDDTPVVFTEQLRKD-DTEVLSYAHAGQ 130
            ..||..||:|||.|.:.|||:.||::|||||||||:||:|.|||||..|..| ::..|||...|:
  Rat    72 LQFLVTFFSRLRPNHSGRYEASFPFLSLCGRERNFLRCEDRPVVFTHLLASDSESPRLSYCGGGE 136

  Fly   131 VLTLPYEPHKLYMDPRNGRVYHPAAPQVGGIGLVRSKLAIELSQHFEFLAGEASPT---HFQWNG 192
            .|.:|:||.:|.....|||:||||..:.||:|||||.||.|||..||:  |..|||   |.||.|
  Rat   137 ALAIPFEPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEY--GPNSPTVPSHVQWQG 199

  Fly   193 ERLEL 197
            .|:.|
  Rat   200 RRIAL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30010NP_001260836.2 DUF4505 29..201 CDD:405623 100/172 (58%)
MGC94207NP_001007752.1 DUF4505 31..207 CDD:291617 101/175 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341733
Domainoid 1 1.000 168 1.000 Domainoid score I3738
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H17079
Inparanoid 1 1.050 168 1.000 Inparanoid score I4067
OMA 1 1.010 - - QHG49130
OrthoDB 1 1.010 - - D1570646at2759
OrthoFinder 1 1.000 - - FOG0007166
OrthoInspector 1 1.000 - - oto96164
orthoMCL 1 0.900 - - OOG6_105754
Panther 1 1.100 - - LDO PTHR31449
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5276
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.910

Return to query results.
Submit another query.