DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30010 and F59C6.12

DIOPT Version :9

Sequence 1:NP_001260836.2 Gene:CG30010 / 246389 FlyBaseID:FBgn0050010 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_001021522.1 Gene:F59C6.12 / 3565901 WormBaseID:WBGene00044251 Length:173 Species:Caenorhabditis elegans


Alignment Length:188 Identity:85/188 - (45%)
Similarity:112/188 - (59%) Gaps:19/188 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LKFVRSPSISCRYVQYNQGQSPEPKIREYFYYIDHEGMLFLDDAKMKNFTSCFKEKDFLKFFFNR 76
            |.|.||        .|.|||. ..||||||||:.|.|.|||||::|||||:.:|:..||.||:.:
 Worm     3 LTFARS--------LYTQGQY-NGKIREYFYYVSHNGFLFLDDSRMKNFTAAYKDIQFLNFFYRK 58

  Fly    77 LRLNKTSRYESEFPYISLCGRERNFIRCDDTPVVFTEQLRKDDTEVLSYAHAGQ-VLTLPYEPHK 140
            ::.|||.|||..||::||||.||||:||||||:|:||   .|.||  .....|| .:...::|..
 Worm    59 IKENKTGRYEDTFPWVSLCGIERNFLRCDDTPLVYTE---LDSTE--KELRIGQSTIYHSFQPSS 118

  Fly   141 LYMDPRNGRVYHPAAPQVGGIGLVRSKLAIELSQHFEFLAGEASPTHFQWNGERLELQ 198
            |.|: .:|||||..  .:||..||..||..:|.:.|.| ..:..|..||...:.:||:
 Worm   119 LSMN-SSGRVYHKC--PIGGKALVADKLTDKLYRRFRF-DDDGVPVGFQCGEQIIELK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30010NP_001260836.2 DUF4505 29..201 CDD:405623 80/171 (47%)
F59C6.12NP_001021522.1 DUF4505 9..171 CDD:291617 79/171 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159831
Domainoid 1 1.000 117 1.000 Domainoid score I3703
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H17079
Inparanoid 1 1.050 117 1.000 Inparanoid score I3375
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49130
OrthoDB 1 1.010 - - D1570646at2759
OrthoFinder 1 1.000 - - FOG0007166
OrthoInspector 1 1.000 - - oto17509
orthoMCL 1 0.900 - - OOG6_105754
Panther 1 1.100 - - LDO PTHR31449
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2873
SonicParanoid 1 1.000 - - X5276
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.