DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30010 and C030006K11Rik

DIOPT Version :9

Sequence 1:NP_001260836.2 Gene:CG30010 / 246389 FlyBaseID:FBgn0050010 Length:215 Species:Drosophila melanogaster
Sequence 2:NP_663447.1 Gene:C030006K11Rik / 223665 MGIID:1925941 Length:218 Species:Mus musculus


Alignment Length:202 Identity:108/202 - (53%)
Similarity:136/202 - (67%) Gaps:12/202 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SRSLTNLKFVRSPSISCR------YVQYNQGQSPEPKIREYFYYIDHEGMLFLDDAKMKNFTSCF 64
            |.::.||..|.:.|...|      .|.|.|||||||:.||||||:||:|.|||||:|||||.:||
Mouse     5 SGAVRNLALVLARSQRARTCSGVERVSYTQGQSPEPRTREYFYYVDHQGQLFLDDSKMKNFITCF 69

  Fly    65 KEKDFLKFFFNRLRLNKTSRYESEFPYISLCGRERNFIRCDDTPVVFTEQLRKD-DTEVLSYAHA 128
            |:..||..||:|||.|.:.|||:.||::|||||||||:||:|.|||||..|..| ::..|||...
Mouse    70 KDLQFLVTFFSRLRPNHSGRYEASFPFLSLCGRERNFLRCEDRPVVFTHLLASDSESPRLSYCGG 134

  Fly   129 GQVLTLPYEPHKLYMDPRNGRVYHPAAPQVGGIGLVRSKLAIELSQHFEFLAGEASPT---HFQW 190
            |:.|.:|:||.:|.....|||:||||..:.||:|||||.||.|||..||:  |.:|||   |..|
Mouse   135 GEALAIPFEPARLLPLAANGRLYHPAPERAGGVGLVRSALAFELSACFEY--GPSSPTVPSHVHW 197

  Fly   191 NGERLEL 197
            .|.|:.|
Mouse   198 QGRRIAL 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30010NP_001260836.2 DUF4505 29..201 CDD:405623 100/173 (58%)
C030006K11RikNP_663447.1 DUF4505 31..207 CDD:291617 101/176 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837958
Domainoid 1 1.000 168 1.000 Domainoid score I3836
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H17079
Inparanoid 1 1.050 168 1.000 Inparanoid score I4154
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49130
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007166
OrthoInspector 1 1.000 - - oto92601
orthoMCL 1 0.900 - - OOG6_105754
Panther 1 1.100 - - LDO PTHR31449
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2873
SonicParanoid 1 1.000 - - X5276
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.930

Return to query results.
Submit another query.