DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30008 and CG18609

DIOPT Version :10

Sequence 1:NP_724853.1 Gene:CG30008 / 246388 FlyBaseID:FBgn0050008 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster


Alignment Length:261 Identity:90/261 - (34%)
Similarity:127/261 - (48%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PWYMITVLVLYLYFVTKAGPHFMEWRKPYELKRLILLHNFIQVVSCIYAIKEVLYITDNTIY--- 83
            ||.:..:|:.||.||.|.|..||..||||:||.::.::|..|          |||   |.:|   
  Fly    21 PWPITLILIAYLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQ----------VLY---NGLYFGM 72

  Fly    84 IFWKCRDIG--------SSPE-----LVRRYYNLAYFLFWLKISELIETVIFVLRKKQNQVSKLH 135
            :|:....:|        |.||     .:.|..:.||.|  .|:.:|::||.|||||...|::.||
  Fly    73 VFYYLFIVGICNLHCIESFPEGHERKQLERVLHAAYLL--NKVLDLMDTVFFVLRKSYKQITFLH 135

  Fly   136 IFHHFSTVTLVYALINFNENGSAAYFCVFLNSIVHVIMYSYYFVAAVADKTLVQALTPVKKCITV 200
            |:||.......|||..:...|........|||:||.:||.|||::  ::...|:|....||.||:
  Fly   136 IYHHVFMSFGSYALTRYYGTGGHVNAVGLLNSLVHTVMYFYYFLS--SEYPGVRANIWWKKYITL 198

  Fly   201 IQMTQFVLILT---QVAFQLVLCGMPPLVLLYFTTVILGMF-YGFYDFYNSAYQASQRRKSQTPQ 261
            .|:.||.::|:   .|.|....||: |..|||...|...:| |.|..||...|....:.|....|
  Fly   199 TQLCQFFMLLSYAIYVRFFSPNCGV-PRGLLYLNMVQGVVFIYLFGKFYIDNYLRPPKAKINAKQ 262

  Fly   262 S 262
            |
  Fly   263 S 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30008NP_724853.1 ELO 17..257 CDD:460083 87/254 (34%)
CG18609NP_611365.2 ELO 16..257 CDD:460083 87/253 (34%)

Return to query results.
Submit another query.