DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30008 and tea

DIOPT Version :10

Sequence 1:NP_724853.1 Gene:CG30008 / 246388 FlyBaseID:FBgn0050008 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster


Alignment Length:70 Identity:14/70 - (20%)
Similarity:28/70 - (40%) Gaps:17/70 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KCRDIGS-SPELVRRYYNLAYFLF----------------WLKISELIETVIFVLRKKQNQVSKL 134
            :|:..|| ||:::........|:|                :.||...||..:.:|...:.::..|
  Fly   125 ECKPSGSESPDVIVNVERCGAFIFPVSFDVFLQCINKMLLFKKIVRSIEHCLVLLSDDERRLLTL 189

  Fly   135 HIFHH 139
            ..|::
  Fly   190 QRFYN 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30008NP_724853.1 ELO 17..257 CDD:460083 14/70 (20%)
teaNP_724855.2 None

Return to query results.
Submit another query.